PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g083520.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 218aa    MW: 24273.8 Da    PI: 10.0935
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g083520.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_153.26.3e-17147199456
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                         ++r  r++kNRe+A rsR+RK+a++ eLe +v+ L +eN +Lkk+ ++l+  +
  Sopim02g083520.0.1 147 DRRNQRMIKNRESAARSRARKQAYMNELESEVAHLVEENARLKKQQQQLRVDA 199
                         68999****************************************99998655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-15144208IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.392146196IPR004827Basic-leucine zipper domain
PfamPF001702.5E-14148196IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-15148197No hitNo description
CDDcd147078.57E-22148195No hitNo description
SuperFamilySSF579594.91E-12148196No hitNo description
PROSITE patternPS000360152166IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MWSSSSDNRG LSASSSSSSS SSHSPFSPRL KTMEEVWKDI NLSSLQDHTT NYSRDHHHLH  60
DHNHQAANFG GMILQDFLAR PFANESSPAA AAAAASPVSA TTMLNLNSVP ELHFFDNPLR  120
QNSILHQPNA SGRKRVVPET EDNSTGDRRN QRMIKNRESA ARSRARKQAY MNELESEVAH  180
LVEENARLKK QQQQLRVDAA NQVPKKNTLY RTSTAPF*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1369190.0EF136919.1 Solanum lycopersicum self-pruning G-box protein (SPGB) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234345.11e-160self-pruning G-box protein
SwissprotQ84JK21e-40FD_ARATH; Protein FD
TrEMBLA1YTV01e-160A1YTV0_SOLLC; Self-pruning G-box protein
STRINGSolyc02g083520.2.11e-159(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35722239
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.11e-36bZIP family protein